DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and Lcp65Ag3

DIOPT Version :9

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:111 Identity:34/111 - (30%)
Similarity:59/111 - (53%) Gaps:16/111 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLLVNFIVALAVLQVQAGSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEG---- 61
            |..|:.| |||..:.:.|.::..|...|:    ::|:..|   .::|.:|||:|.:|...|    
  Fly     1 MKFLIVF-VALFAVALAAPAAEEPTIVRS----ESDVGPE---SFKYDWETSDGQAAQAVGQLND 57

  Fly    62 LG----GVAVQGGSSYTSPEGEVISVNYVADEFGYHPVGAHIPQVP 103
            :|    .::|.|...:.:.:|:...|||:||:.|:.|.|||:|..|
  Fly    58 IGTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLPVAP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 16/54 (30%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:278791 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.