DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and CG15515

DIOPT Version :10

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster


Alignment Length:105 Identity:28/105 - (26%)
Similarity:40/105 - (38%) Gaps:24/105 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVNFIVALAVLQVQAG-SSYI-PDSDRNTRTLQNDLQVERDGK--YRYAYETSNGISASQEGLG 63
            ||...:|||......|| ..|: |       |:.::...:...|  ||:|.|..||  :.:|.:|
  Fly     7 LLFTALVALMAAHSSAGLLDYVFP-------TIVSEYYNQAPTKEGYRFASEEPNG--SKREEMG 62

  Fly    64 GVAVQGG-----------SSYTSPEGEVISVNYVADEFGY 92
            .:...|.           |||...........|.||:.||
  Fly    63 VIMNPGTPDEQLVVMGMYSSYDEKTDTETVTMYTADKDGY 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790 15/57 (26%)
CG15515NP_001263088.1 None

Return to query results.
Submit another query.