DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and Edg78E

DIOPT Version :9

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster


Alignment Length:117 Identity:54/117 - (46%)
Similarity:72/117 - (61%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVNFIVALAVLQVQAGSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEGLGGVAVQ 68
            :..::..||::......:.  :.|...|:.||| ..:.:|.|:|||||||||...:.|....| :
  Fly     1 MYKYLFCLALIGCACADNI--NKDAQIRSFQND-ATDAEGNYQYAYETSNGIQIQEAGNANGA-R 61

  Fly    69 GGSSYTSPEGEVISVNYVADEFGYHPVGAHI---PQVPDYILRSLEYIRTHP 117
            |..:|.|||||.||:.|.|||.||||||.|:   |.||.|:||:||||||||
  Fly    62 GAVAYVSPEGEHISLTYTADEEGYHPVGDHLPTPPPVPAYVLRALEYIRTHP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 25/46 (54%)
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 25/46 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470204
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.