DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and Cpr67Fb

DIOPT Version :10

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:120 Identity:47/120 - (39%)
Similarity:68/120 - (56%) Gaps:12/120 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVNFIVALAVLQVQAGSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEGLGGVAV 67
            |:::..:..|:....       :|...|...:|  :::.||.|.:.|.|||||.|.:.|:|||..
  Fly     6 LIISLFLVAAIRAAD-------ESQAETTKYRN--EIKPDGSYSWEYGTSNGIDAQESGVGGVQA 61

  Fly    68 QGGSSYTSPEGEVISVNYVADEFGYHPVGAHI---PQVPDYILRSLEYIRTHPYQ 119
            .|..||.:|:|..|.:.|.|||.||.|.|||:   |.:|||||::|.||..||:|
  Fly    62 AGSVSYAAPDGTPIQLEYTADENGYRPTGAHLPTPPPIPDYILKALAYIEAHPFQ 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790 22/46 (48%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 22/46 (48%)

Return to query results.
Submit another query.