DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and Cpr67Fa2

DIOPT Version :9

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster


Alignment Length:129 Identity:61/129 - (47%)
Similarity:81/129 - (62%) Gaps:7/129 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IVALAVLQVQAG-SSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEGLGGVAVQGGS 71
            :||.|||....| ::|..::......:.:|:|.|  |.|.|.|||||||:|.:.|:||....||.
  Fly     6 LVASAVLACAYGAATYNQEAGAYITKIGSDIQPE--GNYNYQYETSNGIAAQESGIGGNHANGGF 68

  Fly    72 SYTSPEGEVISVNYVADEFGYHPVGAHI---PQVPDYILRSLEYIRTHP-YQIKDYYTGELKTV 131
            |:.|||||::.::|||||.||.|.||.:   |.:|..|||||||||||| |..::|....||.|
  Fly    69 SWYSPEGELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTHPQYVEQEYRRPALKKV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 26/46 (57%)
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:278791 26/46 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470147
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.