DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and CG13670

DIOPT Version :10

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:192 Identity:39/192 - (20%)
Similarity:70/192 - (36%) Gaps:47/192 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YWHIQKLVKYMKAGNQTATIVA-------------LCCLK------------DHDLTT---QMNQ 66
            ||:...|..:.:.|:..:.|:.             :.|:.            |.::|.   :...
  Fly   185 YWNGNVLNGFKQMGHHFSDIIVHKGVTYVLDSKGIVWCINSDLEMSRYETSLDENMTNGCRRYYM 249

  Fly    67 RAIQDCGGLEVLVNLLESNDMKCRLGALSVLSEISSNLDIRRAIVDLGGIPLLVQILSEPGRDLK 131
            |.:..||.|.|:..|.:.|..|.:    |.|.:.|.....:...:| ..:...|:: ...|.:..
  Fly   250 RFVDCCGELYVIKRLPKENSRKRK----STLFQFSRTAGFKVYKID-KELAKWVEV-KTLGDNAF 308

  Fly   132 IMAAETIANVAKVRLARKLVRKC--NGIPRLVDL------LDVNMNCLRSQRDQLSEEEREM 185
            :||.:|..:|    ||.:.. .|  |.|..:.||      ||.......:::.:.||...||
  Fly   309 VMATDTCFSV----LAHEYY-GCLPNSIYFIEDLEPKVFQLDNGNGSSITRKSESSESSFEM 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790 12/74 (16%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.