DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and Lcp65Ag2

DIOPT Version :10

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_477272.1 Gene:Lcp65Ag2 / 38702 FlyBaseID:FBgn0020637 Length:105 Species:Drosophila melanogaster


Alignment Length:46 Identity:12/46 - (26%)
Similarity:18/46 - (39%) Gaps:13/46 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 GIARDKTVRDNKQLL------------AAATGAI-WKCAASEANVK 334
            |.::.|.||..|:..            |:|.||: ..|..:..|.|
  Fly     9 GSSQSKAVRGEKRAFFFRKWTRIDIARASAVGAVHLLCLLAPFNYK 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790
Lcp65Ag2NP_477272.1 Chitin_bind_4 37..92 CDD:459790 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.