DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and Cpr47Ee

DIOPT Version :9

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster


Alignment Length:172 Identity:51/172 - (29%)
Similarity:69/172 - (40%) Gaps:54/172 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEG----LG---GV---AVQGGSSYTS 75
            :|:|     ....||:|.:  ||.:.|.|.:::|.:|..:|    ||   ||   .:||..||||
  Fly   103 NYVP-----ITAYQNELNL--DGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTS 160

  Fly    76 PEGEVISVNYVADEFGYHPVGAHIPQVPDYILRSLEYIRTHPYQIKDYYTGELKTVEHDAAAFNV 140
            |||..|:|.|:|||.|:...|..||..|.|      :....|||                     
  Fly   161 PEGTPITVRYIADENGFRAEGTGIPSSPQY------FAGAQPYQ--------------------- 198

  Fly   141 YTRNIQDHTIPQSRPSTTPKTIYLTHPPTTTSRPLRQRRALP 182
                 |....|...|..||   :...||...:.|.|.:  ||
  Fly   199 -----QGLLNPNLNPYQTP---FRQLPPPLPNAPFRPQ--LP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 24/56 (43%)
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 24/56 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.