DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and Cpr47Ec

DIOPT Version :10

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster


Alignment Length:109 Identity:26/109 - (23%)
Similarity:51/109 - (46%) Gaps:12/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVNFIVALAVLQVQAGSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEGL----- 62
            :|..|::|   :.|..|.:...|.:|....:.....::.:..|..||..::|||.::|..     
  Fly     4 ILPLFVLA---VMVACGQALPVDPEREPVAILKSEIIKTEEGYTSAYVGADGISRNEEAFLVDKG 65

  Fly    63 ---GGVAVQGGSSYTSPEGEVISVNYVADEFGYHPVGAHI-PQV 102
               ..:.|:|...|.:.:|:.:.|.|.|.:.|:.|.|:.| |::
  Fly    66 TDEEALEVKGSYKYINEDGQEVEVFYTAGKNGFVPYGSIINPEI 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790 14/54 (26%)
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 14/54 (26%)

Return to query results.
Submit another query.