DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and Cpr47Ea

DIOPT Version :9

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:116 Identity:43/116 - (37%)
Similarity:59/116 - (50%) Gaps:20/116 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVNFIVALAVLQVQ--------AGSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQE 60
            ||..:..|:.:|.|        .|:|:    |.|...|:.:..:..||.|:|.|||||||.|.:.
  Fly    11 LVLALCCLSFIQAQPQRGLPPPRGNSF----DANAVILKQNFDLNPDGSYQYNYETSNGIRADEA 71

  Fly    61 G--------LGGVAVQGGSSYTSPEGEVISVNYVADEFGYHPVGAHIPQVP 103
            |        :....:||..|||.|:|.|.::.|:|||.||...|||||..|
  Fly    72 GYLKNPGSQIEAQVMQGSYSYTGPDGVVYTITYIADENGYRAEGAHIPTPP 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 23/54 (43%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 23/54 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439195
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.