DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and Cpr12A

DIOPT Version :9

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:178 Identity:40/178 - (22%)
Similarity:65/178 - (36%) Gaps:29/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVNFIVALAVLQVQAGSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEG------ 61
            |...|:::..::..|    .|.:|..:.|.|........||.|.|.:|..:|.:..:.|      
  Fly     8 LFAIFLLSATLISAQ----QIKESAPSARLLDRFDNRYPDGSYEYRFELDDGTARYERGYFVKIN 68

  Fly    62 -LGGVAVQGGSSYTSPEGEVISVNYVADEFGYHPVGAHIPQVPDYILRSLEYIRTHPYQIKDYYT 125
             :..:.|.|..:|...:|..|:|.|.||:|||....:..||....:.||:|        :.....
  Fly    69 DVKTLMVVGYYAYRMTDGRYITVFYNADQFGYRQNQSITPQEYPNLPRSIE--------VPMVSE 125

  Fly   126 GELKTVEHDAAAFNVYTRNIQDHTIPQSRPSTTPKTIYLTHPPTTTSR 173
            ....:...|..:.:.:....|........||.|          |||.|
  Fly   126 ASAASAASDGVSSSQFQSQFQSRLDAHGNPSIT----------TTTPR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 15/53 (28%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:278791 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.