DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and Cpr49Aa

DIOPT Version :9

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:126 Identity:47/126 - (37%)
Similarity:66/126 - (52%) Gaps:18/126 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVNFIVALAVLQVQAGSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEGL----- 62
            ||::...|...::.||....||       .::.:.:|..||.|:|.|||.|||:|.:||.     
  Fly    11 LLLSLAQARPQVRGQAPGEPIP-------IIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPG 68

  Fly    63 ---GGVAVQGGSSYTSPEGEVISVNYVADEFGYHPVGAHI---PQVPDYILRSLEYIRTHP 117
               .|...||..|||||||..|.:.|:|||.|:.|.|.|:   |.:|..|.::|.|:.|.|
  Fly    69 TDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAYLATAP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 26/54 (48%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 26/54 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439307
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.