DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and LOC1272762

DIOPT Version :10

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_311670.4 Gene:LOC1272762 / 1272762 VectorBaseID:AGAMI1_005929 Length:138 Species:Anopheles gambiae


Alignment Length:65 Identity:16/65 - (24%)
Similarity:26/65 - (40%) Gaps:19/65 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSDEEERWKDPKLTNDVPSEYWHIQKLVKYMKAGNQTATIVALCCLKDHDLTTQMNQRAIQDCGG 74
            ::.|..|.||..|...:|::....:|.|:|....::|                   .||||:.||
Mosquito   123 ATSESNRLKDSPLHRPLPTKLNGYKKTVQYDPRNSET-------------------YRAIQEEGG 168

  Fly    75  74
            Mosquito   169  168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790 7/30 (23%)
LOC1272762XP_311670.4 Chitin_bind_4 48..100 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.