DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcp and Cpr56F

DIOPT Version :10

Sequence 1:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_024667074.1 Gene:Cpr56F / 1271153 VectorBaseID:AGAMI1_009443 Length:181 Species:Anopheles gambiae


Alignment Length:56 Identity:12/56 - (21%)
Similarity:16/56 - (28%) Gaps:23/56 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 THAPLLENIARTLKECASDPESMTLMEELDAIRLIWSLLKNSNPKVQAYAAWALCP 448
            :|.|..|.:..|.|...:.||..                 |..||.:.      ||
Mosquito    73 SHPPTFETLFGTRKARQAYPEQC-----------------NCGPKSEG------CP 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790
Cpr56FXP_024667074.1 Chitin_bind_4 98..149 CDD:459790 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.