DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43322 and ATJ1

DIOPT Version :9

Sequence 1:NP_609092.1 Gene:CG43322 / 33984 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_174142.1 Gene:ATJ1 / 839715 AraportID:AT1G28210 Length:427 Species:Arabidopsis thaliana


Alignment Length:130 Identity:35/130 - (26%)
Similarity:58/130 - (44%) Gaps:22/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFKGSVAIRFGRLLHLK--RKEVYMECFRILGVHESADQNTVRHAYLDLVKRVHPDSGTEEASAE 69
            |.:||....|.|.:|..  ........:.:|||...|.:..::.::.:|.|:.|||:.....||:
plant    23 LRQGSQKPLFERYIHATGINNSSARNYYDVLGVSPKATREEIKKSFHELAKKFHPDTNRNNPSAK 87

  Fly    70 R-FQQVDEAFRVLQEKFAKGRRNIQEDEEGAMEFDIKHTAPQHR--QYLSNEGIGVGTPFQRQKQ 131
            | ||::.||:..|        .|.:..||        :...|:|  .|::|:| |....|:|..|
plant    88 RKFQEIREAYETL--------GNSERREE--------YDKLQYRNSDYVNNDG-GDSERFRRAYQ 135

  Fly   132  131
            plant   136  135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 17/55 (31%)
PLN03085 <168..313 CDD:215566
DUF1992 181..250 CDD:286440
ATJ1NP_174142.1 DnaJ 45..391 CDD:223560 29/108 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.