DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43322 and AT5G03560

DIOPT Version :10

Sequence 1:NP_609092.1 Gene:CG43322 / 33984 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001154694.1 Gene:AT5G03560 / 831789 AraportID:AT5G03560 Length:363 Species:Arabidopsis thaliana


Alignment Length:290 Identity:59/290 - (20%)
Similarity:86/290 - (29%) Gaps:114/290 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PDSGT------EEASAERFQQVDEAF--RVL------QEKFAKGRRN------------------ 91
            ||..|      |:.:.|||..|.:|.  |.|      :..|.:.:||                  
plant    61 PDDLTASSKRKEKKTTERFSAVIDAVHDRKLPPELRGRRDFVRSKRNSNSLFPWFCGGVFARQFS 125

  Fly    92 ------------------IQEDEEGAMEFDIKHTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAM 138
                              ..|:.|..:..|.|...|....|         .||.::...::....
plant   126 SETKRVNTKVNFSLSDDDSDEETETQVTEDSKKQEPPPPPY---------DPFSKKPAIEEPEDP 181

  Fly   139 KAQERVLEHRIDKAAAGEKTLM----SKGGSHFRKH-------AIKTKYGI-DRVVEDLIQEAMS 191
            |..:.:......:....|...|    ||.|   |.|       .||.|..: |.|....|.||.:
plant   182 KNLQEIFHKMRTEGFTNEAVKMFDALSKDG---RTHEALELFSQIKDKNRMPDVVAHTAIVEAYA 243

  Fly   192 KGDFNNLNGSGKP--------LSSAQSQNPY----------LDFTTHKLNK----IMLDNGFTPE 234
            ..      |..|.        |:|..|.|.|          .|..|||..|    .|:.||.:|.
plant   244 NA------GQAKETLKVFMRMLASGVSPNAYTYSVLIKGLAADGKTHKDAKKYLLEMMGNGMSPN 302

  Fly   235 ----------WISLGKD--IRDAIAQLKTK 252
                      ::..||:  .|:.:.::|.|
plant   303 AATYTAVFEAFVREGKEESARELLQEMKGK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 11/38 (29%)
PRK10266 32..>146 CDD:182347 23/136 (17%)
PLN03085 <168..313 CDD:215566 31/127 (24%)
DJC28_CD 181..250 CDD:462766 23/102 (23%)
AT5G03560NP_001154694.1 PLN03085 20..>105 CDD:215566 12/43 (28%)
PLN03081 <195..>322 CDD:215563 33/135 (24%)
PPR repeat 203..226 CDD:276811 8/25 (32%)
PPR_2 230..278 CDD:463778 12/53 (23%)
PPR repeat 234..261 CDD:276811 6/32 (19%)
PPR repeat 267..297 CDD:276811 7/29 (24%)
PPR repeat 303..332 CDD:276811 4/28 (14%)

Return to query results.
Submit another query.