DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43322 and AT4G01395

DIOPT Version :9

Sequence 1:NP_609092.1 Gene:CG43322 / 33984 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001154198.1 Gene:AT4G01395 / 827943 AraportID:AT4G01395 Length:738 Species:Arabidopsis thaliana


Alignment Length:314 Identity:61/314 - (19%)
Similarity:102/314 - (32%) Gaps:99/314 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAGNLFKGSVAI-RFGRLLHLKRKEVYMECFRILGV-HESADQNTVRHAYLDLVKRVHPDSGTEE 65
            |...||.|.:.: ..|..:......:.:.|..||.: ||..:|.|          .|.|.....|
plant   484 LGARLFLGGIGVENTGTEIATALNNMDVSCEYILKLKHEIEEQCT----------EVFPAPADRE 538

  Fly    66 ASAERFQQVDEAFRVLQEKFAKGRRNIQE----------DEEGAMEFDIKHTAPQHRQYLSNEGI 120
            .......::.|.....::....|...:..          |....:.:::..|     :|..||  
plant   539 RIKSCLSELGELSSTFKQLLNSGMEQLVATVTPRIRPVLDTVATISYELTET-----EYAENE-- 596

  Fly   121 GVGTPFQRQKQYQQVRAMKAQERVLEHRIDKAAAGEKTLMSKGGSHFRKHAIKTKYGIDRVVEDL 185
             |..|:.::               |.|.::..||..:.||:........|.|     ||.:|:.|
plant   597 -VNDPWVQR---------------LLHSVETNAAWLQPLMTSNNYDSFLHLI-----IDFIVKRL 640

  Fly   186 IQEAMSKGDFNNLNGSGKPLSSAQSQNPYLDFTTHKLNKIMLDNGFTPEWISLGKDIRDAIA--- 247
             :..|.:..|:.|.|.            .||..|..|  :...:|.|.      :.:||..|   
plant   641 -EVIMMQKRFSQLGGL------------QLDRDTRAL--VSHFSGMTQ------RTVRDKFARLT 684

  Fly   248 QLKTKLRQER-----KYYGE------WPLQ--------------RPDDLAAWKI 276
            |:.|.|..|:     .::||      |.|.              :|:.:||.|:
plant   685 QMATILNLEKVSEILDFWGENSGPMTWRLTPAEVRRVLGLRVEFKPESIAALKL 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 11/55 (20%)
PLN03085 <168..313 CDD:215566 31/137 (23%)
DUF1992 181..250 CDD:286440 16/71 (23%)
AT4G01395NP_001154198.1 Cog4 176..480 CDD:214809
RINT1_TIP1 <625..725 CDD:367942 27/125 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24016
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.