DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43322 and DNAJC28

DIOPT Version :9

Sequence 1:NP_609092.1 Gene:CG43322 / 33984 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001035282.1 Gene:DNAJC28 / 54943 HGNCID:1297 Length:388 Species:Homo sapiens


Alignment Length:339 Identity:129/339 - (38%)
Similarity:193/339 - (56%) Gaps:37/339 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KRKEVYMECFRILGVHESADQNTVRHAYLDLVKRVHPDSGTEEASAERFQQVDEAFR-----VLQ 82
            |.|:...|.:|:|.|.|....:.||.::..|.|:.|||||:..|.:..|.::::|:|     |::
Human    44 KSKKKIREYYRLLNVEEGCSADEVRESFHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSHVIE 108

  Fly    83 EKFAKGRRNIQEDEEGAMEFDIKHTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAMKAQERVLEH 147
            :..|...:.  |:||...:|  |:..||||.|||.||||.|||.||:|.|:|.||.:|.|:|:|:
Human   109 QTNASQSKG--EEEEDVEKF--KYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEY 169

  Fly   148 RIDKAAAGEKTLMSKGGSHFRKHAI----------KTKYGIDRVVEDLIQEAMSKGDFNNLNGSG 202
            :..|       |.|:   :|....|          |....|:|:|||||||:|:||||:||:|.|
Human   170 QKQK-------LQSQ---YFPDSVIVKNIRQSKQQKITQAIERLVEDLIQESMAKGDFDNLSGKG 224

  Fly   203 KPLSSAQSQNPYLDFTTHKLNKIMLDNGFTPEWISLGKDIRDAIAQLKTKLRQERKYYGEWPLQR 267
            |||... |...|:|..||.||:|::|||:.||||...|:|.|.|.||:..:...||..|. |: .
Human   225 KPLKKF-SDCSYIDPMTHNLNRILIDNGYQPEWILKQKEISDTIEQLREAILVSRKKLGN-PM-T 286

  Fly   268 PDDLAAWKIFTLNHQDDVKQLNKLIDKYNLIVPILENQFFRLHLDRMAEPIFKDPELQRNVIR-P 331
            |.:...|.......|:::::|||.|:.:|||||||..|  ::|.|...| |.:..::...:|: .
Human   287 PTEKKQWNHVCEQFQENIRKLNKRINDFNLIVPILTRQ--KVHFDAQKE-IVRAQKIYETLIKTK 348

  Fly   332 EMKSKPSSNLENQG 345
            |:..:..:||: ||
Human   349 EVTDRNPNNLD-QG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 19/59 (32%)
PLN03085 <168..313 CDD:215566 64/154 (42%)
DUF1992 181..250 CDD:286440 39/68 (57%)
DNAJC28NP_001035282.1 DnaJ 51..104 CDD:99751 18/52 (35%)
PLN03085 <200..338 CDD:215566 65/143 (45%)
DUF1992 203..271 CDD:286440 39/68 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148063
Domainoid 1 1.000 82 1.000 Domainoid score I8446
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9869
Inparanoid 1 1.050 199 1.000 Inparanoid score I3798
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49972
OrthoDB 1 1.010 - - D1394654at2759
OrthoFinder 1 1.000 - - FOG0007523
OrthoInspector 1 1.000 - - oto91519
orthoMCL 1 0.900 - - OOG6_106015
Panther 1 1.100 - - LDO PTHR24016
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5522
SonicParanoid 1 1.000 - - X6411
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.