DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43322 and dnajc28

DIOPT Version :9

Sequence 1:NP_609092.1 Gene:CG43322 / 33984 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001015977.1 Gene:dnajc28 / 548731 XenbaseID:XB-GENE-975324 Length:376 Species:Xenopus tropicalis


Alignment Length:330 Identity:128/330 - (38%)
Similarity:194/330 - (58%) Gaps:17/330 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKRKEVYMECFRILGVHESADQNTVRHAYLDLVKRVHPDSGTEEASAERFQQVDEAFRVL---QE 83
            :|.:....:|:|||.|.|......|||:|..|.|:.|||||:..|::.:|.::|||::.|   .:
 Frog    39 IKYRRNIKDCYRILDVPEGCSVEEVRHSYRCLAKKYHPDSGSVSANSGKFMEIDEAYKALLTHLD 103

  Fly    84 KFAKGRRNIQEDEEGAMEFDIKHTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAMKAQERVLEHR 148
            |.|| :...|::||...|:.:    ||||.|||.||:|.|||.||:|||.|.|..:|.::|||.|
 Frog   104 KEAK-KGEGQDNEETQTEYKV----PQHRHYLSFEGVGYGTPSQREKQYTQFRVDRATDQVLEFR 163

  Fly   149 IDKAAA--GEKTLMSKGGSHFRKHAIKTKYGIDRVVEDLIQEAMSKGDFNNLNGSGKPLSSAQSQ 211
            ..|...  .|.:|::|.....:|  :|....|:|:|||||||:|:||||:||:|.||||:.. |.
 Frog   164 KQKLERQYTENSLVAKDVRQSKK--VKITQAIERLVEDLIQESMAKGDFDNLSGKGKPLNKF-SY 225

  Fly   212 NPYLDFTTHKLNKIMLDNGFTPEWISLGKDIRDAIAQLKTKLRQERKYYGEWPLQRPDDLAAWKI 276
            .|::|..||.||:|:::||:.||||.|.|:||:.|..|:.|:...|...|: |: .|.....|:.
 Frog   226 CPHIDPMTHNLNRILIENGYQPEWILLQKEIRETIGTLRNKVLASRAKLGD-PM-TPQKRKQWEE 288

  Fly   277 FTLNHQDDVKQLNKLIDKYNLIVPILENQFFRLHLDRMAEPIFKDPELQRNVIR--PEMKSKPSS 339
            .....::|:.:|||.|:.:||:||:|..|....:..|......|....||..:|  .|:::....
 Frog   289 TCDEFKEDIMKLNKRINDFNLVVPLLNRQMVHFNAAREISQAEKTYASQRETVRKAEEIEADRIE 353

  Fly   340 NLENQ 344
            .|::|
 Frog   354 ELKDQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 23/57 (40%)
PLN03085 <168..313 CDD:215566 60/144 (42%)
DUF1992 181..250 CDD:286440 38/68 (56%)
dnajc28NP_001015977.1 DnaJ 46..98 CDD:197617 22/51 (43%)
PLN03085 <140..331 CDD:215566 78/195 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8253
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9869
Inparanoid 1 1.050 213 1.000 Inparanoid score I3545
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394654at2759
OrthoFinder 1 1.000 - - FOG0007523
OrthoInspector 1 1.000 - - oto105287
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6411
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.