DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43322 and Cog4

DIOPT Version :9

Sequence 1:NP_609092.1 Gene:CG43322 / 33984 FlyBaseID:FBgn0263027 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_609413.1 Gene:Cog4 / 34442 FlyBaseID:FBgn0032258 Length:776 Species:Drosophila melanogaster


Alignment Length:344 Identity:63/344 - (18%)
Similarity:119/344 - (34%) Gaps:113/344 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DSGTEEASAERFQQV-DEAFRV---LQEKFAKGRRNIQEDEEG-AMEFDIKHTAPQHRQYLSNEG 119
            |.||.|...|..|:: ||..:|   |:...|| :..|:....| .....:.||.......|:::.
  Fly    11 DIGTNEQVDETLQRIADEEAKVNEKLESLLAK-QCQIEAKMSGIGRSLSLLHTVDSDSNKLNDQI 74

  Fly   120 IGVGTPFQ------RQKQYQQVRAMKAQERVLE----HRIDKA---AAGEKTLMSKGGSHFRKHA 171
            :......:      |:....:.||.:.|:||.:    |...:.   |.||:. ..|..:|..:..
  Fly    75 VNTAQLAESVSAKVRRLDLARCRASECQQRVHDLIDLHLCSQGVVKAIGEED-YEKSATHIARFL 138

  Fly   172 IKTKYGIDRVVEDLIQEAMSKGDFNNLNGSGKPLSSAQSQNPYLDFTTHKLNKIMLDNGFTPEWI 236
            ...:..:.|..:|:      :|...:::.:.|.|..|..:...|                     
  Fly   139 AMDQQLLRRTADDV------QGSITSVSDAVKTLEDATEKTRVL--------------------- 176

  Fly   237 SLGKDIRDAIAQLKTKLRQERKYYGEWPLQRPDDLAA----WKIFTL--NHQDDVKQLNKLIDKY 295
             :.|...:|:                    :.||||:    :|||.|  .|:..       |:|:
  Fly   177 -IAKRFDEAV--------------------KADDLASVERFFKIFPLVGCHRTG-------IEKF 213

  Fly   296 NLIVPILENQFFRLHLDRMAEPIFKDPELQRNVIRPEMK------SKPSSNLEN----------- 343
            :|.:           ..::|....|:....:::.:.|.:      .:.::.|||           
  Fly   214 SLYI-----------CQKLANKAQKELRNAQDIAKAESRLQLAYADRLTAILENFARVVEVNQPI 267

  Fly   344 ----QGSASTSLFSLISKL 358
                .|.||:||..::|.|
  Fly   268 IEAFYGQASSSLIDMVSIL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43322NP_609092.1 DnaJ 29..84 CDD:197617 10/27 (37%)
PLN03085 <168..313 CDD:215566 21/150 (14%)
DUF1992 181..250 CDD:286440 8/68 (12%)
Cog4NP_609413.1 Cog4 166..497 CDD:214809 30/181 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24016
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.