DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCDC39 and ccdc39

DIOPT Version :9

Sequence 1:NP_852091.1 Gene:CCDC39 / 339829 HGNCID:25244 Length:941 Species:Homo sapiens
Sequence 2:XP_001344625.2 Gene:ccdc39 / 100005620 ZFINID:ZDB-GENE-110603-1 Length:191 Species:Danio rerio


Alignment Length:192 Identity:77/192 - (40%)
Similarity:111/192 - (57%) Gaps:14/192 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   757 MENTLDVIEHLANNVKEKLSEKQAYSFQLSKETEEQKPKLERVTKQCAKLTKEIRLLKDTKDETM 821
            |.|||:.:......:.|.:...||:...|:|:...|:.|:.|..|||||.|||||..|.:.::|.
Zfish     1 MSNTLEGLLQEEKVLNEGIERTQAHVLSLNKDILSQEEKINRAVKQCAKYTKEIRSGKQSTEKTF 65

Human   822 EEQDIKLREMKQFHKVIDEMLVDIIEENTEIRIILQTYFQQSGLELPTASTKGSRQSSRSPSHTS 886
            ||:||:|||::.|:|.|::||:|.:|.|.|:..|||.:|.|:||.||:.|:..|.:.|..||...
Zfish    66 EERDIELRELRDFNKSINKMLLDAMEGNPELSSILQIHFTQAGLSLPSPSSTPSSRLSSKPSSAR 130

Human   887 LSARSSRSTSTSTSQS---------SIKVLELKFPASSSLVGSP--SRPSSASSSSSNVKSK 937
            .||...||::.|.|.|         .:|.::|....|   |.||  |:||||.||.|:.|.|
Zfish   131 SSASLHRSSNLSASSSPRSQSVSSPQMKTVDLGLGLS---VTSPRGSQPSSAGSSRSSSKCK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCDC39NP_852091.1 Smc 22..848 CDD:224117 37/90 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 868..941 29/81 (36%)
ccdc39XP_001344625.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 915 1.000 Domainoid score I555
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 917 1.000 Inparanoid score I2731
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D177902at33208
OrthoFinder 1 1.000 - - FOG0006077
OrthoInspector 1 1.000 - - otm26936
orthoMCL 1 0.900 - - OOG6_103837
Panther 1 1.100 - - LDO PTHR18962
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5539
SonicParanoid 1 1.000 - - X5805
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 1 1.500 - -
1414.500

Return to query results.
Submit another query.