Sequence 1: | NP_001260173.1 | Gene: | snRNP-U1-70K / 33982 | FlyBaseID: | FBgn0016978 | Length: | 448 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010717.1 | Gene: | TIF35 / 852039 | SGDID: | S000002837 | Length: | 274 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 136 | Identity: | 36/136 - (26%) |
---|---|---|---|
Similarity: | 61/136 - (44%) | Gaps: | 22/136 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 MADFEDPKDTPLPKTVETRQERLERRRREKAEQVA---------YKLEREIALWDPTE--IKNAT 97
Fly 98 E-DPFRTLFIARINYDTSESKLRREFEF-YGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAY 160
Fly 161 KHADGK 166 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
snRNP-U1-70K | NP_001260173.1 | U1snRNP70_N | 2..92 | CDD:289024 | 13/56 (23%) |
RRM | <97..>179 | CDD:223796 | 23/72 (32%) | ||
RRM_snRNP70 | 101..188 | CDD:240682 | 21/67 (31%) | ||
TIF35 | NP_010717.1 | eIF3g | 6..127 | CDD:403535 | |
RRM_eIF3G_like | 192..268 | CDD:409842 | 21/65 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S1470 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |