DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and TIF35

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_010717.1 Gene:TIF35 / 852039 SGDID:S000002837 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:36/136 - (26%)
Similarity:61/136 - (44%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 MADFEDPKDTPLPKTVETRQERLERRRREKAEQVA---------YKLEREIALWDPTE--IKNAT 97
            ::..|||         .|.:..:|....|||.||.         ....|.....||:.  .:::.
Yeast   130 LSALEDP---------ATNEGGVEAASEEKAGQVGGAGSIPGQYVPPSRRAGARDPSSDAYRDSR 185

  Fly    98 E-DPFRTLFIARINYDTSESKLRREFEF-YGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAY 160
            | |...||.|.::|.:..|:.||.|..| :.||.::.::.::|:||.:|.||:.:..|.....|.
Yeast   186 ERDDMCTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQAL 250

  Fly   161 KHADGK 166
            :..||:
Yeast   251 RFLDGR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024 13/56 (23%)
RRM <97..>179 CDD:223796 23/72 (32%)
RRM_snRNP70 101..188 CDD:240682 21/67 (31%)
TIF35NP_010717.1 eIF3g 6..127 CDD:403535
RRM_eIF3G_like 192..268 CDD:409842 21/65 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1470
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.