DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and CSTF64

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_177325.2 Gene:CSTF64 / 843510 AraportID:AT1G71800 Length:461 Species:Arabidopsis thaliana


Alignment Length:84 Identity:30/84 - (35%)
Similarity:47/84 - (55%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 RTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGK 166
            |.:|:..|.||.:|.:||......||:....|:.|:|:||||||.|.||:.|....:|.::....
plant     9 RCVFVGNIPYDATEEQLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKDEETALSARRNLQSY 73

  Fly   167 KIDSKRVLVDVERARTVKG 185
            :|:.:::.||.  |...||
plant    74 EINGRQLRVDF--AENDKG 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 30/84 (36%)
CSTF64NP_177325.2 RRM_CSTF2_RNA15_like 9..85 CDD:409832 27/77 (35%)
SF-CC1 <11..212 CDD:273721 29/82 (35%)
CSTF_C 419..454 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.