DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and CSTF64

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_177325.2 Gene:CSTF64 / 843510 AraportID:AT1G71800 Length:461 Species:Arabidopsis thaliana


Alignment Length:84 Identity:30/84 - (35%)
Similarity:47/84 - (55%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 RTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGK 166
            |.:|:..|.||.:|.:||......||:....|:.|:|:||||||.|.||:.|....:|.::....
plant     9 RCVFVGNIPYDATEEQLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKDEETALSARRNLQSY 73

  Fly   167 KIDSKRVLVDVERARTVKG 185
            :|:.:::.||.  |...||
plant    74 EINGRQLRVDF--AENDKG 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024
RRM <97..>179 CDD:223796 27/76 (36%)
RRM_snRNP70 101..188 CDD:240682 30/84 (36%)
CSTF64NP_177325.2 PABP-1234 <11..318 CDD:130689 29/82 (35%)
RRM_CSTF2_CSTF2T 11..85 CDD:241115 26/75 (35%)
CSTF2_hinge 160..228 CDD:373015
PAT1 <222..>433 CDD:370676
CSTF_C 419..454 CDD:373006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1455080at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.