DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and AT1G33470

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_174613.2 Gene:AT1G33470 / 840240 AraportID:AT1G33470 Length:245 Species:Arabidopsis thaliana


Alignment Length:108 Identity:31/108 - (28%)
Similarity:52/108 - (48%) Gaps:17/108 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 FRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHA-- 163
            |..:|:..:.::|.:..||..||.:|.|.:.|:|.|:.||:.|||.|:.:   .|..||.|..  
plant     6 FTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTF---CDPEAAQKACVD 67

  Fly   164 -----DGKKIDSKRVLVDVERARTVKGWLPRRLGGGLGGTRRG 201
                 ||::.:.......|:|::.     ...:.|.:||  ||
plant    68 PAPVIDGRRANCNLAAFGVQRSKP-----SSPIHGHVGG--RG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 26/93 (28%)
AT1G33470NP_174613.2 RRM_RBM24_RBM38_like 7..82 CDD:409818 23/77 (30%)
PABP-1234 <23..189 CDD:130689 28/91 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.