DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and AT5G03580

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_195978.1 Gene:AT5G03580 / 831785 AraportID:AT5G03580 Length:101 Species:Arabidopsis thaliana


Alignment Length:87 Identity:29/87 - (33%)
Similarity:43/87 - (49%) Gaps:5/87 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 FRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADG 165
            |.:|:||.::...||..|...|..:|.:.:.||..|.. |:.:|:||||:|.......|..|.||
plant    16 FTSLYIANLDAQVSEEMLFLMFSDFGKVIRSVLAKDFR-GESRGFAFIEFESADSAGRAMLHMDG 79

  Fly   166 KKIDSKRVLVD----VERARTV 183
            :.|..|.:.|.    ||..|.:
plant    80 RLIGQKILCVQRTPKVEDGRDI 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 29/87 (33%)
AT5G03580NP_195978.1 RRM_SF 19..90 CDD:409669 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.