DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and RBP31

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_194208.1 Gene:RBP31 / 828579 AraportID:AT4G24770 Length:329 Species:Arabidopsis thaliana


Alignment Length:165 Identity:34/165 - (20%)
Similarity:69/165 - (41%) Gaps:33/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KSRGYLGVAKFMADFEDPKDTPLPKTVETRQERLER-------RRREKAEQVAYKLEREIALWDP 90
            :|||:..|.....|           ..||..|:..|       ....||.....:.||...:::|
plant   189 QSRGFGFVTMSSVD-----------EAETAVEKFNRYDLNGRLLTVNKAAPRGSRPERAPRVYEP 242

  Fly    91 TEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERD 155
            .         || :::..:.:|....:|.:.|..:|.:.:..:::|:|:|:.:|:.|:......:
plant   243 A---------FR-VYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDE 297

  Fly   156 MHAAYKHADGKKIDSKRVLVDVERARTVKGWLPRR 190
            ::.|....||:.::.:.:.|:|...|.     |||
plant   298 LNEAISALDGQNLEGRAIRVNVAEERP-----PRR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406 14/65 (22%)
RRM_snRNP70 101..188 CDD:409682 17/86 (20%)
RBP31NP_194208.1 DNA_pol_phi <87..150 CDD:461488
RRM1_PSRP2_like 151..230 CDD:410188 11/51 (22%)
RRM 245..327 CDD:440488 17/87 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.