DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and AT4G13860

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_193122.2 Gene:AT4G13860 / 827020 AraportID:AT4G13860 Length:87 Species:Arabidopsis thaliana


Alignment Length:72 Identity:18/72 - (25%)
Similarity:40/72 - (55%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKI 168
            :::..::..|::..||..|..||.:...:::.|:.:.:.:|:.|:.|....:..||....|||::
plant     5 VYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKEL 69

  Fly   169 DSKRVLV 175
            :.:||.|
plant    70 NGRRVSV 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 18/72 (25%)
AT4G13860NP_193122.2 RRM 2..77 CDD:440488 18/72 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.