DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and CP29

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001190079.1 Gene:CP29 / 824514 AraportID:AT3G53460 Length:363 Species:Arabidopsis thaliana


Alignment Length:199 Identity:47/199 - (23%)
Similarity:79/199 - (39%) Gaps:50/199 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DPTEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHE 153
            |...::..:..|...||:..::::...::|.:.||..|.::.:.:|:|:.:|:.:|:.|:.....
plant    86 DSAPVERNSFSPDLKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTA 150

  Fly   154 RDMHAAYKHADG---KKIDSK-------RVLVDVE---RARTVKGW--LPRR--------LGGGL 195
            .::.||.:..:|   :.:.|.       |||..:|   |...|...  .|:|        ..||.
plant   151 AEVEAAAQQFNGYVSRYLCSLLCLYLLIRVLCGLEFEGRPLRVNAGPPPPKREESFSRGPRSGGY 215

  Fly   196 GGTRRGGNDVNIKHSGREDNERERERYRLER------EREDREGPGRGGGSNGLDARPGRGFGAE 254
            |..|.||                   |..||      ||....|..||||..  ..|.|.|:|..
plant   216 GSERGGG-------------------YGSERGGGYGSERGGGYGSERGGGYG--SQRSGGGYGGS 259

  Fly   255 RRRS 258
            :|.|
plant   260 QRSS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406 1/2 (50%)
RRM_snRNP70 101..188 CDD:409682 21/101 (21%)
CP29NP_001190079.1 U2AF_lg <45..>144 CDD:273727 12/57 (21%)
RRM_SF 100..199 CDD:473069 21/98 (21%)
RRM 278..361 CDD:440488
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.