DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and GRP4

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_189025.1 Gene:GRP4 / 821966 AraportID:AT3G23830 Length:136 Species:Arabidopsis thaliana


Alignment Length:102 Identity:30/102 - (29%)
Similarity:58/102 - (56%) Gaps:6/102 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKI 168
            ||:..:::.|.:|.|::.|..:|.:.:..:|.|:|:|:.:|:.|:.:..|...:.|.|..|||::
plant    37 LFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKEL 101

  Fly   169 DSKRVLVDVERARTVKGWLPRRL---GGGLGGTRRGG 202
            :.:::.|::   .|.:...||..   |||.||...||
plant   102 NGRQIRVNL---ATERSSAPRSSFGGGGGYGGGGGGG 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 21/83 (25%)
GRP4NP_189025.1 PLN03134 1..122 CDD:178680 23/87 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.