DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and RS31a

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_182184.1 Gene:RS31a / 819273 AraportID:AT2G46610 Length:250 Species:Arabidopsis thaliana


Alignment Length:271 Identity:72/271 - (26%)
Similarity:106/271 - (39%) Gaps:52/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 RTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGK 166
            |.:::...:|||..|.|.|.|..:|.:|::    |.:|    ||||:.:|.|||...|.:..|..
plant     2 RHVYVGNFDYDTRHSDLERLFSKFGRVKRV----DMKS----GYAFVYFEDERDAEDAIRRTDNT 58

  Fly   167 KIDSKRVLVDVERARTVKGWLPRRLGGGLGGTRRGGNDVNIKHSGRE------DNERERERYRLE 225
            .....|..:.||.|:..:|   .|      |..|.|..|:.:...:.      |..|.||| .:|
plant    59 TFGYGRRKLSVEWAKDFQG---ER------GKPRDGKAVSNQRPTKTLFVINFDPIRTRER-DME 113

  Fly   226 REREDREGPGRGGGSNGLDARPGRGFG-------AERRRSRSRERRDRERDRGRGAVASNGRSRS 283
            |..|..        ...|:.|..|.|.       .:..::.......:..|:    |.|...:..
plant   114 RHFEPY--------GKVLNVRMRRNFAFVQFATQEDATKALDSTHNSKLLDK----VVSVEYALR 166

  Fly   284 RSRERRKRRAGSRERYDE---FDRRDRRDRERERDRDREREK-----KKKRSKSRERESSRERRE 340
            .:.||..|.||||.|...   :.||...|..|.|..:.:|.|     ::::|....|.||...|.
plant   167 EAGEREDRYAGSRRRRSPSPVYRRRPSPDYTRRRSPEYDRYKGPAPYERRKSPDYGRRSSDYGRA 231

  Fly   341 RKRE-RRDRER 350
            |.|. ..||.|
plant   232 RARSPGYDRSR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 27/85 (32%)
RS31aNP_182184.1 RRM_SF 2..73 CDD:473069 25/78 (32%)
RRM_SF 96..165 CDD:473069 15/81 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.