DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and AT2G37220

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_181259.1 Gene:AT2G37220 / 818299 AraportID:AT2G37220 Length:289 Species:Arabidopsis thaliana


Alignment Length:87 Identity:22/87 - (25%)
Similarity:46/87 - (52%) Gaps:5/87 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKI 168
            :::..:::...:..|...|...|.:.:..:|:|::||:.||:.|:.|:..:::..|.|..||..:
plant   206 VYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADL 270

  Fly   169 DSKRVLVDVERARTVKGWLPRR 190
            |.:::.|....||.     |||
plant   271 DGRQIRVSEAEARP-----PRR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 19/83 (23%)
AT2G37220NP_181259.1 RRM_SF 92..170 CDD:473069
RRM 204..287 CDD:440488 20/85 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.