DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and tia1

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_997793.1 Gene:tia1 / 793165 ZFINID:ZDB-GENE-030131-1506 Length:386 Species:Danio rerio


Alignment Length:79 Identity:24/79 - (30%)
Similarity:40/79 - (50%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 EDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKH 162
            |.| :||::..::.|.:|:.:.:.|...||.|...:|.|.....|  |.|:|:...|...|:...
Zfish     5 EQP-KTLYVGNLSRDVTEALIMQLFGQIGPCKSCKMIVDTAGNDP--YCFVEFFEHRHAAASLAA 66

  Fly   163 ADGKKIDSKRVLVD 176
            .:|:||..|.|.|:
Zfish    67 MNGRKIMGKEVKVN 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 22/76 (29%)
tia1NP_997793.1 RRM1_TIA1 9..82 CDD:410027 22/74 (30%)
RRM2_TIA1 94..171 CDD:410030
RRM3_TIA1 204..275 CDD:410032
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.