powered by:
Protein Alignment snRNP-U1-70K and TIA1
DIOPT Version :9
Sequence 1: | NP_001260173.1 |
Gene: | snRNP-U1-70K / 33982 |
FlyBaseID: | FBgn0016978 |
Length: | 448 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_071505.2 |
Gene: | TIA1 / 7072 |
HGNCID: | 11802 |
Length: | 386 |
Species: | Homo sapiens |
Alignment Length: | 75 |
Identity: | 23/75 - (30%) |
Similarity: | 38/75 - (50%) |
Gaps: | 2/75 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 RTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGK 166
:||::..::.|.:|:.:.:.|...||.|...:|.|.....| |.|:|:...|...||....:|:
Human 7 KTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDP--YCFVEFHEHRHAAAALAAMNGR 69
Fly 167 KIDSKRVLVD 176
||..|.|.|:
Human 70 KIMGKEVKVN 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.