DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and Rbm24

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001074894.1 Gene:Rbm24 / 666794 MGIID:3610364 Length:236 Species:Mus musculus


Alignment Length:81 Identity:25/81 - (30%)
Similarity:44/81 - (54%) Gaps:7/81 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 TEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERD 155
            |..|:.|   :..:|:..:.|.|:::.||:.||.:|.|::.|:|.|:::||.:||.|:.......
Mouse     3 TTQKDTT---YTKIFVGGLPYHTTDASLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAA 64

  Fly   156 MHAAYKH----ADGKK 167
            ...|.|.    .||:|
Mouse    65 AERACKDPNPIIDGRK 80

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity