DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and snrnp35

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001025412.1 Gene:snrnp35 / 569999 ZFINID:ZDB-GENE-050706-77 Length:208 Species:Danio rerio


Alignment Length:237 Identity:73/237 - (30%)
Similarity:101/237 - (42%) Gaps:70/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IALWDPTEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIE 149
            :|.:.|.  :....||..|||:||:|..|:|.|||..|..:|.|:::.|:.|..:|..|.|||||
Zfish    35 LARYKPN--RGVCGDPDLTLFVARLNPQTTEEKLRDVFSKFGDIRRLRLVRDVVTGFSKRYAFIE 97

  Fly   150 YEHERDMHAAYKHADGKKIDSKRVLVDVERARTVKGWLPRRLGGGLGGTRRGGNDVNIKHSGRED 214
            |:.||.:..|::.|:...:|...:|||||:.||:.||.|||||||.||.:..|   .::..||: 
Zfish    98 YKEERSLKRAWRDANKLILDQYELLVDVEQERTLPGWRPRRLGGGQGGQKESG---QLRFGGRD- 158

  Fly   215 NERERERYRLEREREDREGPGRGGGSNGLDARPGR-GFGAERRRSRSRERRDRERDRGRGAVASN 278
                                           ||.| ......||......|:.||:|        
Zfish   159 -------------------------------RPFRKPINLSTRRPAEPRGRETERER-------- 184

  Fly   279 GRSRSRSRERRKRRAGSRERYDEFDRRDRRDRERERDRDRER 320
                                    ||||.|||..||....:|
Zfish   185 ------------------------DRRDYRDRRHERTHTEDR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024 2/6 (33%)
RRM <97..>179 CDD:223796 35/81 (43%)
RRM_snRNP70 101..188 CDD:240682 38/86 (44%)
snrnp35NP_001025412.1 RRM <47..>172 CDD:223796 56/159 (35%)
RRM_snRNP35 47..139 CDD:240683 42/91 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..208 33/137 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.