DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and SC35

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster


Alignment Length:197 Identity:58/197 - (29%)
Similarity:82/197 - (41%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHA 163
            |...:|.:..:.|.|:...|||.||..|.:..|.:..|:.:.:.:|:||:.:..:||...|.:..
  Fly    20 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAM 84

  Fly   164 DGKKIDSKRVLVDVERARTVKGWLPRRLGGGLGGTRRGGNDVNIKHSGREDNERERERYRLERER 228
            ||:.:|.:.  :.|:.||..:...|.|...|    ||||                          
  Fly    85 DGRMLDGRE--LRVQMARYGRPSSPTRSSSG----RRGG-------------------------- 117

  Fly   229 EDREGPGRGGGSNGLDARPGRGFGAERRRSRSRERRDRERDRGRGAVASNGRSR-SRSRERRKRR 292
                  |.||||.|  .|..|.....||||||..||...|.|..|:.:...||: |||..|...|
  Fly   118 ------GGGGGSGG--RRRSRSRSPMRRRSRSPRRRSYSRSRSPGSHSPERRSKFSRSPVRGDSR 174

  Fly   293 AG 294
            .|
  Fly   175 NG 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 23/86 (27%)
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 20/73 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.