DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and Rox8

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:149 Identity:40/149 - (26%)
Similarity:62/149 - (41%) Gaps:22/149 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LEREIAL-W--DPTEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKP 142
            ||:||.: |  .|.............:|:..::.:.....||..|..:|.|....::.|..:.|.
  Fly    71 LEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKS 135

  Fly   143 KGYAFIEYEHERDMHAAYKHADGKKIDSKRVLVDVERARTVKGWLPRRL--------GGGLGGTR 199
            |||||:.:..:.:...|.:..:|:.|.|:.:       ||  .|..|:|        |||.||..
  Fly   136 KGYAFVSFVKKAEAENAIQAMNGQWIGSRSI-------RT--NWSTRKLPPPREPSKGGGQGGGM 191

  Fly   200 RG--GNDVNIKHSGREDNE 216
            .|  ||...:|.|.|...|
  Fly   192 GGGPGNGSGVKGSQRHTFE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024 6/13 (46%)
RRM <97..>179 CDD:223796 17/81 (21%)
RRM_snRNP70 101..188 CDD:240682 20/86 (23%)
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 40/149 (27%)
RRM1_TIA1_like 9..80 CDD:240798 4/8 (50%)
RRM2_TIA1_like 96..170 CDD:240799 19/82 (23%)
RRM3_TIA1_like 221..294 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.