DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and CstF64

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:96 Identity:30/96 - (31%)
Similarity:56/96 - (58%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DPTEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHE 153
            |..:.::..:...|::|:..|.|:.:|.||:..|...||:..:.|:.|:|||||||:.|.||:.:
  Fly     3 DKAQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQ 67

  Fly   154 RDMHAAYKHADGKKIDSKRVLVD---VERAR 181
            ....:|.::.:|.:|..:.:.||   .|::|
  Fly    68 ETALSAMRNLNGYEIGGRTLRVDNACTEKSR 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406 1/2 (50%)
RRM_snRNP70 101..188 CDD:409682 29/84 (35%)
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 27/83 (33%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.