DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and tia1

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_012814227.2 Gene:tia1 / 394890 XenbaseID:XB-GENE-1002876 Length:389 Species:Xenopus tropicalis


Alignment Length:79 Identity:25/79 - (31%)
Similarity:39/79 - (49%) Gaps:2/79 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 EDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKH 162
            ||..|||::..::.|.:|..:.:.|...||.|...:|.|.....|  |.|:|:...|...|:...
 Frog     3 EDLPRTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDP--YCFVEFFEHRHAAASLAA 65

  Fly   163 ADGKKIDSKRVLVD 176
            .:|:||..|.|.|:
 Frog    66 MNGRKIMGKEVKVN 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 23/76 (30%)
tia1XP_012814227.2 RRM1_TIA1 8..81 CDD:410027 22/74 (30%)
RRM2_TIA1 104..181 CDD:410030
RRM3_TIAR 214..286 CDD:241064
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.