DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and rbm24

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_989016.1 Gene:rbm24 / 394612 XenbaseID:XB-GENE-493647 Length:226 Species:Xenopus tropicalis


Alignment Length:81 Identity:26/81 - (32%)
Similarity:44/81 - (54%) Gaps:7/81 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 TEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERD 155
            |..|:.|   :..:|:..:.|.|::|.||:.||.:|.|::.|:|.|:::||.:||.|:.......
 Frog     3 TTQKDTT---YTKIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAA 64

  Fly   156 MHAAYKH----ADGKK 167
            ...|.|.    .||:|
 Frog    65 AERACKDPNPIIDGRK 80

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity