DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and tial1

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_005156854.1 Gene:tial1 / 394107 ZFINID:ZDB-GENE-040426-1547 Length:399 Species:Danio rerio


Alignment Length:92 Identity:24/92 - (26%)
Similarity:40/92 - (43%) Gaps:17/92 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 RTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPK-----------------GYAFIE 149
            :||::..::.|.:|:.:.:.|...||.|...:|.:|.....|                 .|.|:|
Zfish     8 KTLYVGNLSRDVTENLILQLFTQIGPCKSCKMITEQSDSSRKMNSSSIGFSVLQHTSNDPYCFVE 72

  Fly   150 YEHERDMHAAYKHADGKKIDSKRVLVD 176
            :...||..||....:|:||..|.|.|:
Zfish    73 FFEHRDAAAALAAMNGRKILGKEVKVN 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024
RRM <97..>179 CDD:223796 24/92 (26%)
RRM_snRNP70 101..188 CDD:240682 24/92 (26%)
tial1XP_005156854.1 RRM 7..295 CDD:223796 24/92 (26%)
RRM_SF 9..108 CDD:302621 24/91 (26%)
RRM2_TIAR 114..203 CDD:241061
RRM3_TIAR 233..305 CDD:241064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.