DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and PABPN1L

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001372638.1 Gene:PABPN1L / 390748 HGNCID:37237 Length:297 Species:Homo sapiens


Alignment Length:171 Identity:32/171 - (18%)
Similarity:60/171 - (35%) Gaps:39/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 GSRERYDEFDRRDRRDRER-------ERDR-------DREREKKKKRSKSRERESSRERRERKRE 344
            |..|:.:|.|..:.:|.:.       |::.       |:|.|..|.:..:.|:.....|....::
Human    47 GKEEKEEEEDAEEDQDGDAGFLLSLLEQENLAECPLPDQELEAIKMKVCAMEQAEGTPRPPGVQQ 111

  Fly   345 RRDRERGTGSGGDVKERKPDFRDMDVIKIKEEPVDDGYPTFDYQNATIKREIDDEDEEKYRPPPA 409
            :.:.|.||.:|   :...|:.....:....||.|:..:.:....|..:.|             ..
Human   112 QAEEEEGTAAG---QLLSPETVGCPLSGTPEEKVEADHRSVYVGNLCLHR-------------VC 160

  Fly   410 HHNMFSVPPPPILGRGNASTNPNPDNGQQSSGDPSW--WRQ 448
            |..:.:       ||..|...|.|..|.|.:.:.:.  |.|
Human   161 HQGLRA-------GRRGAGPEPLPGPGHQGAAEKNQLPWDQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682
PABPN1LNP_001372638.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..66 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..128 5/29 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.