DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and cstf2

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_009289373.1 Gene:cstf2 / 386806 ZFINID:ZDB-GENE-031118-2 Length:508 Species:Danio rerio


Alignment Length:104 Identity:32/104 - (30%)
Similarity:56/104 - (53%) Gaps:6/104 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ATEDP-----FRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERD 155
            |..||     .|::|:..|.|:.:|.:|:..|...|.:....|::|:|:||||||.|.||:.:..
Zfish    13 AARDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQET 77

  Fly   156 MHAAYKHADGKKIDSKRVLVDVERARTVKGWLPRRLGGG 194
            ..:|.::.:|::...:.:.||...:...|..| :.||.|
Zfish    78 ALSAMRNLNGREFSGRALRVDNAASEKNKEEL-KSLGTG 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024
RRM <97..>179 CDD:223796 26/86 (30%)
RRM_snRNP70 101..188 CDD:240682 25/86 (29%)
cstf2XP_009289373.1 RRM <24..>112 CDD:223796 26/88 (30%)
RRM_CSTF2_CSTF2T 26..100 CDD:241115 23/73 (32%)
CSTF2_hinge 121..199 CDD:291025
CSTF_C 464..504 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1455080at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.