DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and Tial1

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001013211.1 Gene:Tial1 / 361655 RGDID:1595845 Length:392 Species:Rattus norvegicus


Alignment Length:190 Identity:39/190 - (20%)
Similarity:77/190 - (40%) Gaps:29/190 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLALFAAREPIPFMPPVDKLPHEKKSRGYLGVAKFMADFEDPKDTPLPKTVETRQERLERRRREK 73
            :|.||:...|......:.:.|..::....:|.:.......||.     ..||..:      .|:.
  Rat    25 ILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQHTSNDPY-----CFVEFYE------HRDA 78

  Fly    74 AEQVAYK-----LEREIAL-W--DPTEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKK 130
            |..:|..     |.:|:.: |  .|:..|..|.:.|. :|:..::.:.:...::..|..:|.|..
  Rat    79 AAALAAMNGRKILGKEVKVNWATTPSSQK
KDTSNHFH-VFVGDLSPEITTEDIKSAFAPFGKISD 142

  Fly   131 IVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKIDSKRVLVDVERARTVKGWLPRR 190
            ..::.|..:||.|||.|:.:.::.|...|..|..|:.:..:::       ||  .|..|:
  Rat   143 ARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQI-------RT--NWATRK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024 17/90 (19%)
RRM <97..>179 CDD:223796 17/81 (21%)
RRM_snRNP70 101..188 CDD:240682 19/86 (22%)
Tial1NP_001013211.1 RRM1_TIAR 10..107 CDD:410028 17/92 (18%)
RRM2_TIAR 113..192 CDD:410029 19/88 (22%)
RRM3_TIAR 222..294 CDD:241064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.