DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and Snrnp35

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001014149.1 Gene:Snrnp35 / 360803 RGDID:1310724 Length:244 Species:Rattus norvegicus


Alignment Length:265 Identity:95/265 - (35%)
Similarity:129/265 - (48%) Gaps:71/265 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHA 158
            |..|.||..|||:||:|..|.|.||:..|..||.|:::.|:.|..:|..||||||||:.||.:..
  Rat    43 KGVTGDPLLTLFVARLNSQTKEEKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERALLK 107

  Fly   159 AYKHADGKKIDSKRVLVDVERARTVKGWLPRRLGGGLGGTRRGGNDVNIKHSGREDNERERERYR 223
            ||:.|||..||...:.||.|..||::||:||||||||||.:..|   .::..||:...|:.....
  Rat   108 AYRDADGLVIDQHEIFVDYELERTLRGWIPRRLGGGLGGKKESG---QLRFGGRDRPFRKPINLP 169

  Fly   224 LEREREDREGPGRGGGSNGLDARPGRGFGAERR-RSRSRER----RDRERDRGRGAVASNGRSRS 283
            :.:....|||.                  .||| |||||:|    |.||||..||          
  Rat   170 VVKNEPHREGK------------------RERRERSRSRDRHWDPRPRERDHDRG---------- 206

  Fly   284 RSRERRKRRAGSRERYDEFDRRDRRDRER---ERDRDREREKKKKRSKSRERESSRERRERKRER 345
                        ||::       .:||.|   |.|.:||||.:.:|:|:             |::
  Rat   207 ------------REKH-------WQDRARVWPENDWEREREFRDERAKT-------------RDK 239

  Fly   346 RDRER 350
            |||.:
  Rat   240 RDRSK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024
RRM <97..>179 CDD:223796 39/81 (48%)
RRM_snRNP70 101..188 CDD:240682 41/86 (48%)
Snrnp35NP_001014149.1 RRM <41..>126 CDD:223796 39/82 (48%)
RRM_snRNP35 48..137 CDD:240683 43/88 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..244 41/160 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto97012
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.