DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment snRNP-U1-70K and CSTF2T

DIOPT Version :9

Sequence 1:	NP_001260173.1	Gene:	snRNP-U1-70K / 33982	FlyBaseID:	FBgn0016978	Length:	448	Species:	Drosophila melanogaster
Sequence 2:	NP_056050.1	Gene:	CSTF2T / 23283	HGNCID:	17086	Length:	616	Species:	Homo sapiens

Alignment Length:	92	Identity:	28/92 - (30%)
Similarity:	53/92 - (57%)	Gaps:	5/92 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    85 IALWDPTEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIE 149
            :|:.||     |.:...|::|:..|.|:.:|.:|:..|...|.:....|::|:|:||||||.|.|
Human     4 LAVRDP-----AMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCE 63

  Fly   150 YEHERDMHAAYKHADGKKIDSKRVLVD 176
            |:.:....:|.::.:|::...:.:.||
Human    64 YQDQETALSAMRNLNGREFSGRALRVD 90

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
snRNP-U1-70K	NP_001260173.1	U1snRNP70_N	2..92	CDD:289024	3/6 (50%)
		RRM	<97..>179	CDD:223796	24/80 (30%)
		RRM_snRNP70	101..188	CDD:240682	24/76 (32%)
CSTF2T	NP_056050.1	RRM	<16..>109	CDD:223796	24/75 (32%)
		RRM_CSTF2_CSTF2T	18..92	CDD:241115	23/73 (32%)
		CSTF2_hinge	113..191	CDD:291025
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	203..241
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	262..418
		9 X 5 AA tandem repeats of M-E-T-R-[AG]	418..462
		9 X 5 AA tandem repeats of G-[AT]-G-[MI]-Q	505..549
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	542..573
		CSTF_C	572..612	CDD:291002
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1455080at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.920