powered by:
Protein Alignment snRNP-U1-70K and sup-12
DIOPT Version :9
Sequence 1: | NP_001260173.1 |
Gene: | snRNP-U1-70K / 33982 |
FlyBaseID: | FBgn0016978 |
Length: | 448 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508674.1 |
Gene: | sup-12 / 180674 |
WormBaseID: | WBGene00006321 |
Length: | 248 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 22/71 - (30%) |
Similarity: | 36/71 - (50%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 FRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKH--- 162
|..:|:..:.|.||:..|...||.:|.|::.|:|.|:.:.|.:||.|:..:.......|.|.
Worm 34 FTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNP 98
Fly 163 -ADGKK 167
.||:|
Worm 99 IIDGRK 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1267 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.