DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and sup-12

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_508674.1 Gene:sup-12 / 180674 WormBaseID:WBGene00006321 Length:248 Species:Caenorhabditis elegans


Alignment Length:71 Identity:22/71 - (30%)
Similarity:36/71 - (50%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 FRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKH--- 162
            |..:|:..:.|.||:..|...||.:|.|::.|:|.|:.:.|.:||.|:..:.......|.|.   
 Worm    34 FTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNP 98

  Fly   163 -ADGKK 167
             .||:|
 Worm    99 IIDGRK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024
RRM <97..>179 CDD:223796 22/71 (31%)
RRM_snRNP70 101..188 CDD:240682 22/71 (31%)
sup-12NP_508674.1 RRM_RBM24_RBM38_like 35..110 CDD:240830 21/70 (30%)
ELAV_HUD_SF <37..>209 CDD:273741 21/68 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1267
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.