DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and rnp-7

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_498565.2 Gene:rnp-7 / 176002 WormBaseID:WBGene00004390 Length:332 Species:Caenorhabditis elegans


Alignment Length:326 Identity:153/326 - (46%)
Similarity:187/326 - (57%) Gaps:54/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTQYLPPNLLALFAAREPIPFMPPVDKLPHEK--KSRGYLGVAKFMADFEDPKDTPLPKTVETRQ 63
            ||.:|||||||||.||.|:.::||...|..:|  |.....|||:::..||||||||....|.|:.
 Worm     1 MTAFLPPNLLALFEARPPVQYLPPCQDLLVDKNAKRAPMTGVAQYIQLFEDPKDTPAKIPVVTKA 65

  Fly    64 ERLERRRREKAEQVAYKLEREIALWDPTEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPI 128
            |..|.:||:|.|.:|||:|:.||.|:|.|...|:|||:||||:.||||:|||||||||||.||.|
 Worm    66 EAKEEKRRQKDELLAYKVEQGIATWNPAENPRASEDPYRTLFVGRINYETSESKLRREFEAYGKI 130

  Fly   129 KKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKIDSKRVLVDVERARTVKGWLPRRLGG 193
            ||:.::|| |:|||:|||||||..:.:||.|||.|||.|:|.||::||.||.||.|.||||||||
 Worm   131 KKLTMVHD-EAGKPRGYAFIEYSDKAEMHTAYKKADGIKVDGKRLVVDYERGRTQKTWLPRRLGG 194

  Fly   194 GLGGTRR-----------------GGNDVNIKHSGREDNERERERYRLEREREDREGPGRGGGSN 241
            |.|.||:                 ||        |.||.:|||     ...|:.|:...|.||.|
 Worm   195 GKGDTRKTREAKSVIEEREIASGFGG--------GYEDRDRER-----SGSRDRRQDSYRNGGGN 246

  Fly   242 GLDARP-----------GRGFGAERRRSRSRERRDRERDRGRGAVASNGRSRSRSRERRKRRAGS 295
            ..|.|.           |.|||.        ..|||..||..|  ...|..|.|..:|...|.||
 Worm   247 DRDRRESSGGFRDNRGGGGGFGG--------GGRDRFNDRSGG--GGYGGDRDRGGDRGGDRGGS 301

  Fly   296 R 296
            |
 Worm   302 R 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024 45/91 (49%)
RRM <97..>179 CDD:223796 54/81 (67%)
RRM_snRNP70 101..188 CDD:240682 57/86 (66%)
rnp-7NP_498565.2 U1snRNP70_N 4..94 CDD:371969 44/89 (49%)
RRM_snRNP70 103..192 CDD:240682 60/89 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166409
Domainoid 1 1.000 103 1.000 Domainoid score I4287
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 259 1.000 Inparanoid score I1922
Isobase 1 0.950 - 0 Normalized mean entropy S1470
OMA 1 1.010 - - QHG54339
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005136
OrthoInspector 1 1.000 - - oto18223
orthoMCL 1 0.900 - - OOG6_102349
Panther 1 1.100 - - LDO PTHR13952
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1267
SonicParanoid 1 1.000 - - X3654
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.