DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and rsp-5

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_495307.3 Gene:rsp-5 / 174073 WormBaseID:WBGene00004702 Length:208 Species:Caenorhabditis elegans


Alignment Length:255 Identity:75/255 - (29%)
Similarity:104/255 - (40%) Gaps:72/255 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKI 168
            |::.:|.|:..|..:.|..:.||.|..|.:.:        |:||:::|..||...|....|||.:
 Worm     4 LYLGKIPYNARERDVERFLKGYGKINNISMKY--------GFAFVDFEDSRDAEDACHDLDGKTM 60

  Fly   169 D--SKRVLVDVERARTVKGWLPRRLGGGLGGTRRGGNDVNIKHSGREDNERERERYRLEREREDR 231
            :  |.|::|::.|.:      ||            |||   :|..|....|.|     ...|..|
 Worm    61 EGSSMRLVVEMARGK------PR------------GND---RHGSRSPRRRSR-----SPRRRSR 99

  Fly   232 EGPGRGGGSNGLDARPGRGFGAERRRSRSRERRDRERDRGRGAVASNGRSRSRSRERRKRRAGSR 296
            ..|                    |||||||:|:...|.|.|    |:.||||..||.| ||:.||
 Worm   100 TPP--------------------RRRSRSRDRKRSRRSRSR----SSSRSRSPVRESR-RRSESR 139

  Fly   297 ERYDEFDRRDRRDRERE----RDRDREREKK-------KKRSKSRERESSRERRERKRER 345
            ....:.|.:....|.|.    :||.|.|...       :|||.||.|..||:...|...|
 Worm   140 SPSPKRDLKREASRSRSPLPAKDRSRTRSGSPPKNGGDRKRSVSRGRSHSRDGSNRSVSR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024
RRM <97..>179 CDD:223796 22/76 (29%)
RRM_snRNP70 101..188 CDD:240682 23/85 (27%)
rsp-5NP_495307.3 RRM <3..>77 CDD:223796 23/86 (27%)
RRM_SF 3..74 CDD:302621 22/77 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.