DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and tiar-1

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_495121.1 Gene:tiar-1 / 173967 WormBaseID:WBGene00015943 Length:408 Species:Caenorhabditis elegans


Alignment Length:134 Identity:32/134 - (23%)
Similarity:54/134 - (40%) Gaps:25/134 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LEREIAL-W--DP--TEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESG 140
            |:||:.: |  :|  .:.|..|...|. :|:..::.:....|||..|:.:|.:....:|.|..:.
 Worm   110 LDREMKVNWAVEPGQQQSKIDTTRHFH-VFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTT 173

  Fly   141 KPKGYAFIEYEHERDMHAAYKHADGKKIDSKRVLVDVERARTVKGWLPRRLGGGLGGTRRGGNDV 205
            |.|||.|:.|....:...|.:..:|:                   ||.||.......||:.|:..
 Worm   174 KSKGYGFVSYPKREEAERAIEQMNGQ-------------------WLGRRTIRTNWATRKPGDQE 219

  Fly   206 NIKH 209
            ...|
 Worm   220 KPSH 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024 5/15 (33%)
RRM <97..>179 CDD:223796 18/81 (22%)
RRM_snRNP70 101..188 CDD:240682 18/86 (21%)
tiar-1NP_495121.1 PABP-1234 47..>302 CDD:130689 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.